PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G075000.1
Common NamePHAVU_009G075000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 345aa    MW: 38152 Da    PI: 7.6025
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G075000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.3e-171462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W++eEd +l+ +++q+G+g +W + ++++g++R++k+c++rw++yl
  Phvul.009G075000.1 14 KGPWSPEEDAKLKSYIEQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                        79*********************************************97 PP

2Myb_DNA-binding38.23.3e-1269111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Phvul.009G075000.1  69 GGFSEEEDNIICSLYVSIGSR-WSVIAAQLP-GRTDNDIKNYWNT 111
                         569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.467962IPR017930Myb domain
SuperFamilySSF466891.28E-2611109IPR009057Homeodomain-like
SMARTSM007175.4E-131364IPR001005SANT/Myb domain
PfamPF002496.1E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-251569IPR009057Homeodomain-like
CDDcd001673.43E-101662No hitNo description
PROSITE profilePS5129420.99963117IPR017930Myb domain
SMARTSM007174.7E-1167115IPR001005SANT/Myb domain
PfamPF002495.8E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2370117IPR009057Homeodomain-like
CDDcd001672.21E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKSYIE QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYVSIGSRW SVIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
HRKELQARNK GNGVVKQESN SSLLLQENSV QQQPCWPQIP ALPLSPYTSQ TPSFNDQDSI  180
RKLLIKLGGR FSDDYQPILD GLNLQFPHVS LSSTQQIQEE EHVSSSGCMN SIGNSQVQFG  240
QSAYCSELVQ GQVSFASAAI GEMVSTNDYS QRLLGGLEFF YGEEMISDKI MGGCASSSCC  300
GQSTNWGETS SLMYPPLVAS SFEGLRQEMP RESGFQELSY PGTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136795.10.0hypothetical protein PHAVU_009G075000g
SwissprotQ9M2Y95e-90RAX3_ARATH; Transcription factor RAX3
TrEMBLV7AT920.0V7AT92_PHAVU; Uncharacterized protein
STRINGGLYMA06G05260.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-79myb domain protein 84